PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araha.12732s0027.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family Dof
Protein Properties Length: 195aa    MW: 22068.4 Da    PI: 6.4998
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araha.12732s0027.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof106.81.1e-332175559
                zf-Dof  5 alkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknk 59
                           + cprC s++tkfCy+nny  sqPry Ck CrryWt+GGalrn+P+Gg++rk+k
  Araha.12732s0027.1.p 21 PRVCPRCYSDQTKFCYFNNYKKSQPRYKCKDCRRYWTHGGALRNIPIGGSCRKSK 75
                          578**************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5088426.9532276IPR003851Zinc finger, Dof-type
PfamPF027011.8E-292275IPR003851Zinc finger, Dof-type
PROSITE patternPS0136102460IPR003851Zinc finger, Dof-type
ProDomPD0074781.0E-172975IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0048359Biological Processmucilage metabolic process involved in seed coat development
GO:0048825Biological Processcotyledon development
GO:2000032Biological Processregulation of secondary shoot formation
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 195 aa     Download sequence    Send to blast
MDTLNVFANE DNQVNVVKPP PRVCPRCYSD QTKFCYFNNY KKSQPRYKCK DCRRYWTHGG  60
ALRNIPIGGS CRKSKLPKID QSSVSQMASV EIQPGNHQFL SENQENISVS ASSSSPTIGN  120
HFGYFSELHE VANLSPTRSF LTMDHLDFGD ESFQQDLYDV GSNDLIGNPW INQSIGGNVD  180
NHNDQRKLQY EYES*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00445DAPTransfer from AT4G21030Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002869912.11e-133hypothetical protein ARALYDRAFT_914579
SwissprotQ9SUB12e-92DOF42_ARATH; Dof zinc finger protein DOF4.2
TrEMBLD7MFF91e-133D7MFF9_ARALL; Putative uncharacterized protein
STRINGscaffold_702321.11e-133(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM16021789
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G21030.13e-79Dof-type zinc finger domain-containing protein